| request information: |
|
| Catalog Code: | H00011060-A01 |
| Product Name: | WWP2 Antibody |
| Product Description: | Mouse Polyclonal anti-WWP2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11060 |
| Gene Symbol: | WWP2 |
| Omim ID: | 602308 |
| Immunogen: | WWP2 (NP_008945, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQS
HLDLKVWSCHTLRNELLGTASVNLSNVLKNN* |
| Specificity: | WWP2 - WW domain containing E3 ubiquitin protein ligase 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. The encoded protein contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AIP2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |