| Catalog Code: | H00011059-M01 |
| Product Type: | Primary Antibody |
| Product Name: | WWP1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 11059 |
| Host: | Mouse |
| Clone: | 1A7 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-WWP1 (1A7) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = WWP1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.WW domain-containing |
| Alternate Names: | anti-AIP5 antibody, anti-DKFZp434D2111 antibody, anti-Tiul1 antibody, anti-hSDRP1 antibody |
| Immunogen: | WWP1 (NP_008944, 152 a.a. ~ 261 a.a) partial recombinant protein with GST tag. |
| Epitope: | CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT* ... |
| Specificity: | WWP1 - WW domain containing E3 ubiquitin protein ligase 1 |
| Purity: | IgG purified |
| Packaging: | 0.1 ml IgG purified Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is 5 (2 ug), 5 (10 ug), and 5 (25 ug). |
| Gene Symbol: | WWP1 |
| Omim ID: | 602307, |