ExactAntigen

Mouse Monoclonal anti-NUDT21 (2G4-6F11)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00011051-M01A
ProductName:NUDT21 Antibody
Product Description:Mouse Monoclonal anti-NUDT21 (2G4-6F11)
Clone:2G4-6F11
Clonality:Monoclonal
Immunogen:NUDT21 (AAH01403, 1 a.a. ~ 228 a.a) full length recombinant protein with GST tag.
Epitope:MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein on ELISA.
Background:The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA
SpeciesSummary:Hu
ALTnames:anti-CFIM25 antibody, anti-CPSF5 antibody, anti-DKFZp686H1588 antibody
ProteinTarget:nudix (nucleoside diphosphate linked moiety X)-type motif 21
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:11051
Gene_Symbol:NUDT21
Omim_ID:604978,
see all human NUDT21 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about