ExactAntigen

NUDT21 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00011051-M01
Product Name:NUDT21 Antibody
Product Description:Mouse Monoclonal anti-NUDT21 (2G4-6F11)
Clone:2G4-6F11
Clonality:Monoclonal
ListPrice:295
Gene ID:11051
Gene Symbol:NUDT21
Omim ID:604978,
Immunogen:NUDT21 (AAH01403, 1 a.a. ~ 228 a.a) full length recombinant protein with GST tag.
Epitope:MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRT
VEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQY
PYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN*
Specificity:NUDT21 - nudix (nucleoside diphosphate linked moiety X)-type motif 21
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate for western blot. It has also been used for ELISA.
Background:The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu ,
Alternate Names:anti-CFIM25 antibody, anti-CPSF5 antibody, anti-DKFZp686H1588 antibody
Package Size:0.05 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human NUDT21 antibodies


2008©ExactAntigen home | browse | about