| CatalogCode: | H00011046-M03 |
| ProductName: | SLC35D2 Antibody |
| Product Description: | Mouse Monoclonal anti-SLC35D2 (1H5) |
| Clone: | 1H5 |
| Clonality: | Monoclonal |
| Immunogen: | SLC35D2 (NP_008932, 74 a.a. ~ 132 a.a) partial recombinant protein with GST tag. |
| Epitope: | VSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPLT* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Nucleotide sugars, which are synthesized in the cytosol or the nucleus, are high-energy donor substrates for glycosyltransferases located in the lumen of the endoplasmic reticulum and Golgi apparatus. Translocation of nucleotide sugars from the cytosol into the lumen compartment is mediated by specific nucleotide sugar transporters, such as SLC35D2 (Suda et al., 2004 [PubMed 15082721]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Lambda |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-HFRC1 antibody, anti-MGC117215 antibody, anti-SQV7L antibody, anti-UGTrel8 antibody, anti-hfrc antibody |
| ProteinTarget: | solute carrier family 35, member D2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 11046 |
| Gene_Symbol: | SLC35D2 |
| Omim_ID: | 609182, |
order or
more information: | company product webpage |
| request information: |
|