| request information: |
|
| Catalog Code: | H00011009-A01 |
| Product Name: | IL24 Antibody |
| Product Description: | Mouse Polyclonal anti-IL24 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11009 |
| Gene Symbol: | IL24 |
| Omim ID: | 604136 |
| Immunogen: | IL24 (AAH09681, 58 a.a. ~ 167 a.a) partial recombinant protein with GST tag. |
| Epitope: | GPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLK
SFSTLANNFVLIVSQLQPSQENEMFSIRDSA |
| Specificity: | IL24 - interleukin 24 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to ELISA on the immunizing protein. |
| Background: | This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, |
| Species Summary: | Hu |
| Alternate Names: | anti-C49A antibody, anti-FISP antibody, anti-IL-24 antibody, anti-IL10B antibody, anti-MDA7 antibody, anti-Mob-5 antibody, anti-ST16 antibody, anti-mda-7 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |