ExactAntigen

SF3B2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010992-M01
Product Type:Primary Antibody
Product Name:SF3B2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10992
Host:Mouse
Clone:5D2
Product Description:Mouse Monoclonal anti-SF3B2 (5D2)
Species Summary:Mu, Rt
Background:This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-m
Alternate Names:anti-SAP145 antibody, anti-SF3B145 antibody, anti-SF3b1 antibody, anti-SF3b150 antibody
Immunogen:SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Epitope:YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY* ...
Purity:IgG purified
Buffer:1x PBS, pH 7.2
Packaging:100 ug IgG purified Mouse ascites.
Package Size:100 ug
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SF3B2
Omim ID:605591,
see all human SF3B2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about