| Catalog Code: | H00010992-M01 |
| Product Type: | Primary Antibody |
| Product Name: | SF3B2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 10992 |
| Host: | Mouse |
| Clone: | 5D2 |
| Product Description: | Mouse Monoclonal anti-SF3B2 (5D2) |
| Species Summary: | Mu, Rt |
| Background: | This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-m |
| Alternate Names: | anti-SAP145 antibody, anti-SF3B145 antibody, anti-SF3b1 antibody, anti-SF3b150 antibody |
| Immunogen: | SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag. |
| Epitope: | YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY* ... |
| Purity: | IgG purified |
| Buffer: | 1x PBS, pH 7.2 |
| Packaging: | 100 ug IgG purified Mouse ascites. |
| Package Size: | 100 ug |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | SF3B2 |
| Omim ID: | 605591, |
|