| request information: |
|
| Catalog Code: | H00010992-A01 |
| Product Name: | splicing factor 3b, subunit 2, 145kDa Antibody |
| Product Description: | Mouse Polyclonal anti-splicing factor 3b, subunit 2, 145kDa |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10992 |
| Gene Symbol: | SF3B2 |
| Omim ID: | 605591, |
| Immunogen: | SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag. |
| Epitope: | YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY* |
| Specificity: | splicing factor 3b, subunit 2, 145kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SAP145 antibody, anti-SF3B145 antibody, anti-SF3b1 antibody, anti-SF3b150 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |