| request information: |
|
| Catalog Code: | H00010954-M01 |
| Product Name: | PDIA5 Antibody |
| Product Description: | Mouse Monoclonal anti-PDIA5 (3A3) |
| Clone: | 3A3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10954 |
| Gene Symbol: | PDIA5 |
| Immunogen: | PDIA5 (NP_006801, 31 a.a. ~ 131 a.a) partial recombinant protein with GST tag. |
| Epitope: | ERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVE
LFHYQDGAFHTEYNRAVTFKS* |
| Specificity: | PDIA5 - protein disulfide isomerase family A, member 5 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ30401 antibody, anti-PDIR antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |