| request information: |
|
| Catalog Code: | H00010926-M01 |
| Product Name: | DBF4 Antibody |
| Product Description: | Mouse Monoclonal anti-DBF4 (6G9) |
| Clone: | 6G9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10926 |
| Gene Symbol: | DBF4 |
| Omim ID: | 604281, |
| Immunogen: | DBF4 (NP_006707, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
| Epitope: | NSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLS
KDISYLISNKKEAKFAQT* |
| Specificity: | DBF4 - DBF4 homolog (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-ASK antibody, anti-DBF4A antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |