| request information: |
|
| Catalog Code: | H00010920-B01 |
| Product Name: | COPS8 Antibody |
| Product Description: | Mouse Polyclonal anti-COPS8 - COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) |
| Clone: | COP9 constitutive photomorphogenic homol |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 10920 |
| Gene Symbol: | COPS8 |
| Immunogen: | COPS8 (AAH03090, 1 a.a. ~ 210 a.a) full-length human protein. |
| Epitope: | MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQ
RIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADST
TRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
| Background: | The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-COP9 antibody, anti-CSN8 antibody, anti-MGC1297 antibody, anti-MGC43256 antibody, anti-SGN8 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |