| request information: |
|
| Catalog Code: | H00010916-M04 |
| Product Name: | MAGED2 Antibody |
| Product Description: | Mouse Monoclonal anti-MAGED2 (6G10) |
| Clone: | 6G10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10916 |
| Gene Symbol: | MAGED2 |
| Omim ID: | 300470, |
| Immunogen: | MAGED2 (NP_055414, 16 a.a. ~ 126 a.a) partial recombinant protein with GST tag. |
| Epitope: | AEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSKATEVSKTPEAREAPATQASSTTQLTDTQV
LAAENKSLAADTKKQNADPQAVTMPATETKK* |
| Specificity: | MAGED2 - melanoma antigen family D, 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene is a member of the MAGED gene family. While the MAGEA and MAGEB genes are silent in normal tissues with the exception of testis and placenta, the MAGED genes are expressed ubiquitously. The MAGED genes are clustered on chromosome Xp11. This gene is located in Xp11.2, a hot spot for X-linked mental retardation (XLMR). Multiple alternatively spliced transcript variants have been found for this gene, however, the full length nature of some variants has not been defined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-11B6 antibody, anti-BCG1 antibody, anti-HCA10 antibody, anti-JCL-1 antibody, anti-MAGE-D2 antibody, anti-MAGED antibody, anti-MGC8386 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |