ExactAntigen

GADD45G Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010912-M01
Product Type:Primary Antibody
Product Name:GADD45G Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10912
Host:Mouse
Clone:1D3
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-GADD45G (1D3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = GADD45G PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-CR6 antibody, anti-DDIT2 antibody, anti-GADD45gamma antibody, anti-GRP17 antibody
Immunogen:GADD45G (AAH19325, 1 a.a. ~ 160 a.a) full length recombinant protein with GST tag.
Epitope:MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE* ...
Specificity:GADD45G - growth arrest and DNA-damage-inducible, gamma
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:GADD45G
Omim ID:604949,
see all human GADD45G antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about