| request information: |
|
| Catalog Code: | H00010910-A02 |
| Product Name: | SUGT1 Antibody |
| Product Description: | Mouse Polyclonal anti-SUGT1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10910 |
| Gene Symbol: | SUGT1 |
| Omim ID: | 604098 |
| Immunogen: | SUGT1 (AAH00911, 1 a.a. ~ 334 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNS
TAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIK
NVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQF
VADVKNLYPSSSPYTRNW |
| Specificity: | SUGT1 - SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SGT1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |