ExactAntigen

XLKD1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010894-B01
Product Type:Primary Antibody
Product Name:XLKD1 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:10894
Host:Mouse
Product Description:Mouse Polyclonal anti-XLKD1 - extracellular link domain containing 1, MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis
Alternate Names:anti-CRSBP-1 antibody, anti-HAR antibody, anti-LYVE-1 antibody
Immunogen:XLKD1 (-, 1 a.a. ~ 322 a.a) full-length human protein.
Epitope:MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIRKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLG ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human LYVE 1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about