| request information: | |
| Catalog Code: | H00010892-A01 |
| Product Name: | MALT1 Antibody |
| Product Description: | Mouse Polyclonal anti-MALT1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10892 |
| Gene Symbol: | MALT1 |
| Omim ID: | 604860 |
| Immunogen: | MALT1 (AAH30143, 685 a.a. ~ 784 a.a) partial recombinant protein with GST tag. |
| Epitope: | EDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPA DSCHCSRTPDAFISSFAHHAS |
| Specificity: | MALT1 - mucosa associated lymphoid tissue lymphoma translocation gene 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene has been found to be recurrently rearranged in chromosomal translocation with two other genes - baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) and immunoglobulin heavy chain locus - in mucosa-associated lymphoid tissue lymphomas. The protein encoded by this gene may play a role in NF-kappaB activation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp434L132 antibody, anti-MLT antibody, anti-MLT1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |