| request information: |
|
| Catalog Code: | H00010891-M05 |
| Product Name: | PPARGC1A Antibody |
| Product Description: | Mouse Monoclonal anti-PPARGC1A - peroxisome proliferative activated receptor, gamma, coactivator 1, alpha (1E11) |
| Clone: | 1E11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10891 |
| Gene Symbol: | PPARGC1A |
| Immunogen: | PPARGC1A (NP_037393, 689 a.a. ~ 799 a.a) partial recombinant protein with GST tag. |
| Epitope: | TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSN
SDDFDPASTKSKYDSLDFDSLLKEAQRSLRR* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-LEM6 antibody, anti-PGC-1(alpha) antibody, anti-PGC-1v antibody, anti-PGC1 antibody, anti-PGC1A antibody, anti-PPARGC1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |