| CatalogCode: | H00010891-M03 |
| ProductName: | peroxisome proliferative activated receptor, gamma, coactivator 1, alpha Antibody |
| Product Description: | Mouse Monoclonal anti-peroxisome proliferative activated receptor, gamma, coactivator 1, alpha (1F3) |
| Clone: | 1F3 |
| Clonality: | Monoclonal |
| Immunogen: | PPARGC1A (NP_037393, 689 a.a. ~ 799 a.a) partial recombinant protein with GST tag. |
| Epitope: | TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR* ... |
| Specificity: | peroxisome proliferative activated receptor, gamma, coactivator 1, alpha |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-LEM6 antibody, anti-PGC-1(alpha) antibody, anti-PGC-1v antibody, anti-PGC1 antibody, anti-PGC1A antibody, anti-PPARGC1 antibody |
| ProteinTarget: | peroxisome proliferative activated receptor, gamma, coactivator 1, alpha |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 10891 |
| Gene_Symbol: | PPARGC1A |
| Omim_ID: | 604517, |
order or
more information: | company product webpage |
| request information: |
|