ExactAntigen

ACTL7B Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010880-M01
Product Type:Primary Antibody
Product Name:ACTL7B Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10880
Host:Mouse
Clone:6A4
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-ACTL7B (6A4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feat
Immunogen:ACTL7B (NP_006677, 286 a.a. ~ 378 a.a) partial recombinant protein with GST tag.
Epitope:GKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERK* ...
Specificity:ACTL7B - actin-like 7B
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ACTL7B
Omim ID:604304,
see all human ACTL7B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about