| request information: |
|
| Catalog Code: | H00010858-M01 |
| Product Name: | CYP46A1 Antibody |
| Product Description: | Mouse Monoclonal anti-CYP46A1 (1A11) |
| Clone: | 1A11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10858 |
| Gene Symbol: | CYP46A1 |
| Omim ID: | 604087, |
| Immunogen: | CYP46A1 (NP_006659, 201 a.a. ~ 301 a.a) partial recombinant protein with GST tag. |
| Epitope: | TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQI
LKAEEGAQDDEGLLDNFVTFF* |
| Specificity: | CYP46A1 - cytochrome P450, family 46, subfamily A, polypeptide 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CP46 antibody, anti-CYP46 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |