| CatalogCode: | H00010842-B01 |
| ProductType: | Primary Antibody |
| ProductName: | C7orf16 Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 10842 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-C7orf16 - chromosome 7 open reading frame 16, MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GSBS antibody |
| Immunogen: | C7orf16 (NP_006649, 1 a.a. ~ 155 a.a) full-length human protein. |
| Epitope: | MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |