| request information: |
|
| Catalog Code: | H00010818-B01 |
| Product Name: | FRS2 Antibody |
| Product Description: | Mouse Polyclonal anti-FRS2 - fibroblast growth factor receptor substrate 2, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 10818 |
| Gene Symbol: | FRS2 |
| Immunogen: | FRS2 (AAH21562, 1 a.a. ~ 512 a.a) full-length human protein. |
| Epitope: | MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRR
CQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGD
ASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIED
RDPQILLEPEGVKFVLGP |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-FRS2A antibody, anti-FRS2alpha antibody, anti-SNT antibody, anti-SNT-1 antibody, anti-SNT1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |