| request information: |
|
| Catalog Code: | H00010800-A01 |
| Product Name: | CYSLTR1 Antibody |
| Product Description: | Mouse Polyclonal anti-CYSLTR1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10800 |
| Gene Symbol: | CYSLTR1 |
| Omim ID: | 300201 |
| Immunogen: | CYSLTR1 (AAH35750, 248 a.a. ~ 337 a.a) partial recombinant protein with GST tag. |
| Epitope: | PYHIQRTIHLHFLHNETKPCDSVLTMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKAS
LPEKGEEICKV |
| Specificity: | CYSLTR1 - cysteinyl leukotriene receptor 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR2. This encoded receptor is a member of the superfamily of G protein-coupled receptors. Activation of this receptor by LTD4 results in contraction and proliferation of smooth muscle, oedema, eosinophil migration and damage to the mucus layer in the lung. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CYSLT1 antibody, anti-CYSLT1R antibody, anti-CYSLTR antibody, anti-HG55 antibody, anti-HMTMF81 antibody, anti-MGC46139 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |