| request information: |
|
| Catalog Code: | H00010785-M01 |
| Product Name: | WDR4 Antibody |
| Product Description: | Mouse Monoclonal anti-WDR4 (1F9) |
| Clone: | 1F9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10785 |
| Gene Symbol: | WDR4 |
| Omim ID: | 605924 |
| Immunogen: | WDR4 (AAH01074, 1 a.a. ~ 267 a.a) full length recombinant protein with GST tag. |
| Epitope: | MLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLH
CCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTSVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLW
VLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQL
EKKQRRRSPPPGPDGHAK |
| Specificity: | WDR4 - WD repeat domain 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |