| request information: |
|
| Catalog Code: | H00010783-A01 |
| Product Name: | NEK6 Antibody |
| Product Description: | Mouse Polyclonal anti-NEK6 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10783 |
| Gene Symbol: | NEK6 |
| Omim ID: | 604884 |
| Immunogen: | NEK6 (AAH00101, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIF
EMMDAKARQDCVKEIGLLKQL |
| Specificity: | NEK6 - NIMA (never in mitosis gene a)-related kinase 6 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against tissue lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SID6-1512 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |