| request information: |
|
| Catalog Code: | H00010772-M03 |
| Product Name: | FUSIP1 Antibody |
| Product Description: | Mouse Monoclonal anti-FUSIP1 (1A6) |
| Clone: | 1A6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10772 |
| Gene Symbol: | FUSIP1 |
| Omim ID: | 605221, |
| Immunogen: | FUSIP1 (AAH05039, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGR
QIEIQFAQGDRKTPNQMKAKE* |
| Specificity: | FUSIP1 - FUS interacting protein (serine/arginine-rich) 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Background: | This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FUSIP2 antibody, anti-NSSR antibody, anti-SRp38 antibody, anti-SRrp40 antibody, anti-TASR antibody, anti-TASR1 antibody, anti-TASR2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |