| request information: |
|
| Catalog Code: | H00010768-M05 |
| Product Name: | AHCYL1 Antibody |
| Product Description: | Mouse Monoclonal anti-AHCYL1 (5D6) |
| Clone: | 5D6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10768 |
| Gene Symbol: | AHCYL1 |
| Omim ID: | 607826, |
| Immunogen: | AHCYL1 (NP_006612, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAA
SYTDSSDDEVSPREKQQTNSKG* |
| Specificity: | AHCYL1 - S-adenosylhomocysteine hydrolase-like 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DCAL antibody, anti-IRBIT antibody, anti-PRO0233 antibody, anti-XPVKONA antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |