| request information: |
|
| Catalog Code: | H00010755-A02 |
| Product Name: | RGS19IP1 Antibody |
| Product Description: | Mouse Polyclonal anti-RGS19IP1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10755 |
| Gene Symbol: | GIPC1 |
| Omim ID: | 605072 |
| Immunogen: | GIPC1 (NP_005707, 61 a.a. ~ 159 a.a) partial recombinant protein with GST tag. |
| Epitope: | HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKS
EDALGLTITDNGAGYAFIK* |
| Specificity: | GIPC1 - GIPC PDZ domain containing family, member 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-C19orf3 antibody, anti-GIPC antibody, anti-GLUT1CBP antibody, anti-Hs.6454 antibody, anti-IIP-1 antibody, anti-MGC15889 antibody, anti-MGC3774 antibody, anti-NIP antibody, anti-RGS19IP1 antibody, anti-SEMCAP antibody, anti-SYNECTIIN antibody, anti-TIP-2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |