| request information: |
|
| Catalog Code: | H00010753-M02 |
| Product Name: | CAPN9 Antibody |
| Product Description: | Mouse Monoclonal anti-CAPN9 (3A6) |
| Clone: | 3A6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10753 |
| Gene Symbol: | CAPN9 |
| Omim ID: | 606401, |
| Immunogen: | CAPN9 (NP_006606, 591 a.a. ~ 691 a.a) partial recombinant protein with GST tag. |
| Epitope: | DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALS
TKNKEFIHLNINEFIHLTMNI* |
| Specificity: | CAPN9 - calpain 9 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This gene is thought to be associated with gastric cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GC36 antibody, anti-nCL-4 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |