| request information: |
|
| Catalog Code: | H00010752-A01 |
| Product Name: | CHL1 Antibody |
| Product Description: | Mouse Polyclonal anti-CHL1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10752 |
| Gene Symbol: | CHL1 |
| Omim ID: | 607416 |
| Immunogen: | CHL1 (NP_006605, 26 a.a. ~ 136 a.a) partial recombinant protein with GST tag. |
| Epitope: | EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQ
GKYRCFASNKLGIAMSEEIEFIVPSVPKFPK* |
| Specificity: | CHL1 - cell adhesion molecule with homology to L1CAM (close homolog of L1) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a member of the L1 gene family of neural cell adhesion molecules. It is a neural recognition molecule that may be involved in signal transduction pathways. The deletion of one copy of this gene may be responsible for mental defects in patients with 3p- syndrome. Several alternatively spliced transcript variants of this gene have been described, but their full length nature is not known. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CALL antibody, anti-L1CAM2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |