| request information: |
|
| Catalog Code: | H00010726-M01 |
| Product Name: | NUDC Antibody |
| Product Description: | Mouse Monoclonal anti-NUDC (5G12) |
| Clone: | 5G12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10726 |
| Gene Symbol: | NUDC |
| Immunogen: | NUDC (AAH02399, 1 a.a. ~ 332 a.a) full length recombinant protein with GST tag. |
| Epitope: | MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEA
ERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGK
LKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIED
GKVVTVHLEKINKMEWWS |
| Specificity: | NUDC - nuclear distribution gene C homolog (A. nidulans) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | NudC was first identified as a regulator of nuclear movement in the asexual reproductive cycle of the filamentous fungus Aspergillus nidulans. Human NUDC is a nuclear movement protein that associates with dynein (see DYNC1H1; MIM 600112) (Aumais et al., 2003 [PubMed 12679384]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-HNUDC antibody, anti-MNUDC antibody, anti-NPD011 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |