| CatalogCode: | H00010726-B01 |
| ProductName: | NUDC Antibody |
| Product Description: | Mouse Polyclonal anti-NUDC - nuclear distribution gene C homolog (A. nidulans), MaxPab Antibody |
| Clonality: | Polyclonal |
| Immunogen: | NUDC (NP_006591, 1 a.a. ~ 331 a.a) full-length human protein. |
| Epitope: | MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWS ... |
| CrossReactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| Background: | NudC was first identified as a regulator of nuclear movement in the asexual reproductive cycle of the filamentous fungus Aspergillus nidulans. Human NUDC is a nuclear movement protein that associates with dynein (see DYNC1H1; MIM 600112) (Aumais et al., 2003 [PubMed 12679384]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-HNUDC antibody, anti-MNUDC antibody, anti-NPD011 antibody |
| ProteinTarget: | nuclear distribution gene C homolog (A. nidulans) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 10726 |
| Gene_Symbol: | NUDC |
order or
more information: | company product webpage |
| request information: |
|