ExactAntigen

NFAT5 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010725-M01
Product Type:Primary Antibody
Product Name:NFAT5 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10725
Host:Mouse
Clone:2G1
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-NFAT5 (2G1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = NFAT5 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-KIAA0827 antibody, anti-NFATL1 antibody, anti-OREBP antibody, anti-TONEBP antibody
Immunogen:NFAT5 (NP_006590, 1422 a.a. ~ 1532 a.a) partial recombinant protein with GST tag.
Epitope:FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF* ...
Specificity:NFAT5 - nuclear factor of activated T-cells 5, tonicity-responsive
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NFAT5
Omim ID:604708,
see all human NFAT5 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about