| CatalogCode: | H00010725-A01 |
| ProductName: | NFAT5 Antibody |
| Product Description: | Mouse Polyclonal anti-NFAT5 |
| Clonality: | Polyclonal |
| Immunogen: | NFAT5 (NP_006590, 1422 a.a. ~ 1532 a.a) partial recombinant protein with GST tag. |
| Epitope: | FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF* ... |
| Specificity: | NFAT5 - nuclear factor of activated T-cells 5, tonicity-responsive |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-KIAA0827 antibody, anti-NFATL1 antibody, anti-OREBP antibody, anti-TONEBP antibody |
| ProteinTarget: | NFAT5 - nuclear factor of activated T-cells 5, tonicity-responsive |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 10725 |
| Gene_Symbol: | NFAT5 |
| Omim_ID: | 604708 H00010725-M01 |
order or
more information: | company product webpage |
| request information: |
|