| CatalogCode: | H00010717-M03 |
| ProductName: | adaptor-related protein complex 4, beta 1 subunit Antibody |
| Product Description: | Mouse Monoclonal anti-adaptor-related protein complex 4, beta 1 subunit (1B2) |
| Clone: | 1B2 |
| Clonality: | Monoclonal |
| Immunogen: | AP4B1 (NP_006585, 640 a.a. ~ 740 a.a) partial recombinant protein with GST tag. |
| Epitope: | VAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELLLEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS* ... |
| Specificity: | adaptor-related protein complex 4, beta 1 subunit |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The heterotetrameric adaptor protein (AP) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. AP4 is composed of 2 large chains, beta-4 (AP4B1) and epsilon-4 (AP4E1; MIM 607244), a medium chain, mu-4 (AP4M1; MIM 602296), and a small chain, sigma-4 (AP4S1; MIM 607243).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-BETA-4 antibody |
| ProteinTarget: | adaptor-related protein complex 4, beta 1 subunit |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 10717 |
| Gene_Symbol: | AP4B1 |
| Omim_ID: | 607245, |
order or
more information: | company product webpage |
| request information: |
|