| request information: |
|
| Catalog Code: | H00010717-M01 |
| Product Name: | AP4B1 Antibody |
| Product Description: | Mouse Monoclonal anti-AP4B1 (1B7) |
| Clone: | 1B7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10717 |
| Gene Symbol: | AP4B1 |
| Omim ID: | 607245, |
| Immunogen: | AP4B1 (NP_006585, 640 a.a. ~ 740 a.a) partial recombinant protein with GST tag. |
| Epitope: | VAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELLLEPGNSEMQISVKQNEARTE
TLNSFISVLETVIGTIEEIKS* |
| Specificity: | AP4B1 - adaptor-related protein complex 4, beta 1 subunit |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The heterotetrameric adaptor protein (AP) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. AP4 is composed of 2 large chains, beta-4 (AP4B1) and epsilon-4 (AP4E1; MIM 607244), a medium chain, mu-4 (AP4M1; MIM 602296), and a small chain, sigma-4 (AP4S1; MIM 607243).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BETA-4 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |