| request information: |
|
| Catalog Code: | H00010714-M01 |
| Product Name: | POLD3 Antibody |
| Product Description: | Mouse Monoclonal anti-POLD3 (3E2) |
| Clone: | 3E2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10714 |
| Gene Symbol: | POLD3 |
| Immunogen: | POLD3 (NP_006582, 357 a.a. ~ 467 a.a) partial recombinant protein with GST tag. |
| Epitope: | PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGC IVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREER KGPKKGTAALGKANRQVSITGFFQRK* |
| Specificity: | POLD3 - polymerase (DNA-directed), delta 3, accessory subunit |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3, and POLD4 (MIM 611525) (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KIAA0039 antibody, anti-P66 antibody, anti-P68 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |