| request information: |
|
| Catalog Code: | H00010714-A01 |
| Product Name: | POLD3 Antibody |
| Product Description: | Mouse Polyclonal anti-POLD3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10714 |
| Gene Symbol: | POLD3 |
| Immunogen: | POLD3 (NP_006582, 357 a.a. ~ 467 a.a) partial recombinant protein with GST tag. |
| Epitope: | PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKE
PREERKGPKKGTAALGKANRQVSITGFFQRK* |
| Specificity: | POLD3 - polymerase (DNA-directed), delta 3, accessory subunit |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3, and POLD4 (MIM 611525) (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KIAA0039 antibody, anti-P66 antibody, anti-P68 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |