| request information: |
|
| Catalog Code: | H00010693-M01 |
| Product Name: | CCT6B Antibody |
| Product Description: | Mouse Monoclonal anti-CCT6B (1A4) |
| Clone: | 1A4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10693 |
| Gene Symbol: | CCT6B |
| Immunogen: | CCT6B (AAH27591, 1 a.a. ~ 531 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAAIKAVNSKAEVARAQAALAVNICAARGLQDVLRTNLGPKGTMKMLASGAGDIKLTKDGNVLLDEMQIQHPTASLIAK
VATAQDDVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAKIKALEVLEEVKVTKEMKRKILLDVARTSLQT
KVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKLGTDTKLIQGLVLDHGARHPDMKKRVEDAFILICNVSL
EYEKTEVNSGFFYKTAEE |
| Specificity: | CCT6B - chaperonin containing TCP1, subunit 6B (zeta 2) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-CCT-zeta-2 antibody, anti-CCTZ-2 antibody, anti-Cctz2 antibody, anti-TCP-1-zeta-2 antibody, anti-TSA303 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |