| request information: |
|
| Catalog Code: | H00010691-A01 |
| Product Name: | GMEB1 Antibody |
| Product Description: | Mouse Polyclonal anti-GMEB1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10691 |
| Gene Symbol: | GMEB1 |
| Omim ID: | 604409 |
| Immunogen: | GMEB1 (NP_077808, 467 a.a. ~ 564 a.a) partial recombinant protein with GST tag. |
| Epitope: | TAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAE
MEEHQHQVHNVEIVVLED* |
| Specificity: | GMEB1 - glucocorticoid modulatory element binding protein 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene is a member of KDWK gene family. The product of this gene associates with GMEB2 protein, and the complex is essential for parvovirus DNA replication. Study of rat homolog implicates the role of this gene in modulation of transactivation by the glucocorticoid receptor bound to glucocorticoid response elements. Two alternative spliced transcript variants encoding different isoforms exist. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-P96PIF antibody, anti-PIF96 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |