| request information: |
|
| Catalog Code: | H00010681-A01 |
| Product Name: | guanine nucleotide binding protein (G protein), beta 5 Antibody |
| Product Description: | Mouse Polyclonal anti-guanine nucleotide binding protein (G protein), beta 5 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10681 |
| Gene Symbol: | GNB5 |
| Omim ID: | 604447, |
| Immunogen: | GNB5 (NP_057278, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Epitope: | MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVE
LHQVAERVEAL* |
| Specificity: | guanine nucleotide binding protein (G protein), beta 5 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GB5 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |