| request information: |
|
| Catalog Code: | H00010675-M01 |
| Product Name: | CSPG5 Antibody |
| Product Description: | Mouse Monoclonal anti-CSPG5 (5C11) |
| Clone: | 5C11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10675 |
| Gene Symbol: | CSPG5 |
| Omim ID: | 606775, |
| Immunogen: | CSPG5 (NP_006565, 445 a.a. ~ 540 a.a) partial recombinant protein with GST tag. |
| Epitope: | KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPN DDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQAD LDVNCLQNNLT* |
| Specificity: | CSPG5 - chondroitin sulfate proteoglycan 5 (neuroglycan C) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Endoplasmic reticulum, Golgi Apparatus and Plasma membrane |
| Background: | Neuroglycan C is a transmembrane chondroitin sulfate proteoglycan that is exclusively expressed in the central nervous system. NGC gene expression is developmentally regulated being altered by addiction to psychostimulants and by nerve lesion. Its core protein has a particular multidomain structure differing from those of other known proteoglycans, and this protein is modified post-translationally in various ways such as phosphorylation and glycosylation. Neuroglycan C is a novel part-time proteoglycan that changes its structure from a proteoglycan form to a non-proteoglycan form without chondroitin sulfate chains during the development of the cerebellum and retina. Evidence suggests that Neuroglycan C is involved in neuronal circuit formation in the central nervous system. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Neuroglycan C antibody, anti-Acidic leucine-rich EGF-like domain-containing brain protein antibody, anti-Caleb antibody, anti-Chondroitin sulfate proteoglycan 5 antibody, anti-Cspg5 antibody, anti-Ngc antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |