| request information: | |
| Catalog Code: | H00010668-M01 |
| Product Name: | CGRRF1 Antibody |
| Product Description: | Mouse Monoclonal anti-CGRRF1 (2E12) |
| Clone: | 2E12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10668 |
| Gene Symbol: | CGRRF1 |
| Omim ID: | 606138 |
| Immunogen: | CGRRF1 (AAH15063, 36 a.a. ~ 333 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAAVFLVTLYEYSPLFYIAVVFTCFIVTTGLVLGWFGWDVPVILRNSEETQFSTRVFKKQMRQVKNPFGLEITNPSSAS ITTGITLTTDCLEDSLLTCYWGCNVQKLYEALQKHVYCFRISTPQALEDALYSEYLYQEQYFIKKDSKEEIYCQLPRDT KIEDFGTVPRSRYPLVALLTLADEDDREIYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFT PSNNSSSEEKNTDRSLLE |
| Specificity: | CGRRF1 - cell growth regulator with ring finger domain 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-CGR19 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |