ExactAntigen

KLF1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00010661-M05
Product Name:KLF1 Antibody
Product Description:Mouse Monoclonal anti-KLF1 (2A6)
Clone:2A6
Clonality:Monoclonal
ListPrice:295
Gene ID:10661
Gene Symbol:KLF1
Omim ID:600599,
Immunogen:KLF1 (NP_006554, 183 a.a. ~ 238 a.a) partial recombinant protein with GST tag.
Epitope:PRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS*
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG3 Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-EKLF antibody
Package Size:0.1 mg
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human EKLF antibodies


2008©ExactAntigen home | browse | about