| request information: |
|
| Catalog Code: | H00010653-B03 |
| Product Name: | SPINT2 Antibody |
| Product Description: | Mouse Polyclonal anti-SPINT2 - serine peptidase inhibitor, Kunitz type, 2, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 10653 |
| Gene Symbol: | SPINT2 |
| Immunogen: | SPINT2 (AAH12868, 1 a.a. ~ 253 a.a) full-length human protein. |
| Epitope: | MAQLCGLRRSRAFLALLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYL
TKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSC
NNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVLLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWS
SGDDKERLVKNTYVL* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-HAI-2 antibody, anti-HAI2 antibody, anti-Kop antibody, anti-PB antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |