| request information: |
|
| Catalog Code: | H00010598-M01 |
| Product Name: | AHSA1 Antibody |
| Product Description: | Mouse Monoclonal anti-AHSA1 (1A2-A8) |
| Clone: | 1A2-A8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10598 |
| Gene Symbol: | AHSA1 |
| Omim ID: | 608466 |
| Immunogen: | AHSA1 (AAH00321, 1 a.a. ~ 339 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASINNRKGKLIF
FYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEGVKLLREAMGIYISTLKTE
FTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTH
APATLEADRGGKFHMVDG |
| Specificity: | AHSA1 - AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AHA1 antibody, anti-C14orf3 antibody, anti-p38 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |