| request information: |
|
| Catalog Code: | H00010587-M01 |
| Product Name: | TXNRD2 Antibody |
| Product Description: | Mouse Monoclonal anti-TXNRD2 (3A7-F1) |
| Clone: | 3A7-F1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10587 |
| Gene Symbol: | TXNRD2 |
| Omim ID: | 606448, |
| Immunogen: | TXNRD2 (AAH07489, 1 a.a. ~ 429 a.a) full length recombinant protein with GST tag. |
| Epitope: | MHQAALLGGLIQDAPNYGWEVAQPVPHDWRKMAEAVQNHVKS LNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTL VVGASYVALECAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMV IEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTGKEDT GTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKI |
| Specificity: | TXNRD2 - thioredoxin reductase 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Localization: | Mitochondrial |
| Background: | Thioredoxin reductase (TR) is a dimeric NADPH-dependent FAD containing enzyme that catalyzes the reduction of the active site disulfide of thioredoxin and other substrates. TR is a member of a family of pyridine nucleotide-disulfide oxidoreductases and is a key enzyme in the regulation of the intracellular redox environment. Three thioredoxin reductase genes have been found that encode selenocysteine containing proteins. This gene partially overlaps the COMT gene on chromosome 22. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-selenoprotein Z antibody, anti-SELZ antibody, anti-Thioredoxin reductase 2 antibody, anti-Thioredoxin reductase 2 mitochondrial antibody, anti-thioredoxin reductase 3 antibody, anti-thioredoxin reductase beta antibody, anti-TR 3 antibody, anti-TR antibody, anti-TR beta antibody, anti-TR3 antibody, anti-TRXR 2 antibody, anti-TRXR2 antibody, anti-TXNRD 2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |