| request information: |
|
| Catalog Code: | H00010570-A01 |
| Product Name: | DPYSL4 Antibody |
| Product Description: | Mouse Polyclonal anti-DPYSL4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10570 |
| Gene Symbol: | DPYSL4 |
| Omim ID: | 608407 |
| Immunogen: | DPYSL4 (NP_006417, 461 a.a. ~ 560 a.a) partial recombinant protein with GST tag. |
| Epitope: | VTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGF
SLSGSQADDHIARRTAQKIM* |
| Specificity: | DPYSL4 - dihydropyrimidinase-like 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CRMP3 antibody, anti-DRP-4 antibody, anti-ULIP4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |