| request information: |
|
| Catalog Code: | H00010563-B01 |
| Product Name: | CXCL13 Antibody |
| Product Description: | Mouse Polyclonal anti-CXCL13 - chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant), MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 10563 |
| Gene Symbol: | CXCL13 |
| Immunogen: | CXCL13 (AAH12589, 1 a.a. ~ 110 a.a) full-length human protein. |
| Epitope: | MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDP
QAEWIQRMMEVLRKRSSSTLPVPVFKRKIP* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control. |
| Background: | B lymphocyte chemoattractant, independently cloned and named Angie, is a CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ANGIE antibody, anti-ANGIE2 antibody, anti-BCA-1 antibody, anti-BCA1 antibody, anti-BLC antibody, anti-BLR1L antibody, anti-SCYB13 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |