| CatalogCode: | H00010554-B01 |
| ProductName: | AGPAT1 Antibody |
| Product Description: | Mouse Polyclonal anti-AGPAT1 - 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), MaxPab Antibody |
| Clonality: | Polyclonal |
| Immunogen: | AGPAT1 (AAH02402, 1 a.a. ~ 284 a.a) full-length human protein. |
| Epitope: | MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVR ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-1-AGPAT1 antibody, anti-G15 antibody, anti-LPAAT-alpha antibody, anti-LPAATA antibody, anti-MGC4007 antibody, anti-MGC5423 antibody |
| ProteinTarget: | 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 10554 |
| Gene_Symbol: | AGPAT1 |
order or
more information: | company product webpage |
| request information: |
|